PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G61120.1
Common NameAGL13, T20K12.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 244aa    MW: 27967.6 Da    PI: 6.9175
Description AGAMOUS-like 13
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G61120.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.21.2e-29959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+ rqvtfskR+ g+lKKA+ELSvLCdaev++iifs+ gklye+s+
  AT3G61120.1  9 KRIENKITRQVTFSKRKSGLLKKAYELSVLCDAEVSLIIFSTGGKLYEFSN 59
                 79***********************************************95 PP

2K-box87.92e-29821691198
        K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                   ++++ l+qe++kLk ++e+L r++R+l+GedLe +s+keLq Le+qLe +l+  R++K+++++eq+eel++ke+el ++n++L+ + 
  AT3G61120.1  82 LEDTQGLRQEVTKLKCKYESLLRTHRNLVGEDLEGMSIKELQTLERQLEGALSATRKQKTQVMMEQMEELRRKERELGDINNKLKLET 169
                  567899******************************************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.127161IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-38160IPR002100Transcription factor, MADS-box
CDDcd002659.85E-40278No hitNo description
SuperFamilySSF554553.79E-31283IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-303859IPR002100Transcription factor, MADS-box
PfamPF014865.8E-2584168IPR002487Transcription factor, K-box
PROSITE profilePS5129714.45985175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010468Biological Processregulation of gene expression
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGRGKVEVKR IENKITRQVT FSKRKSGLLK KAYELSVLCD AEVSLIIFST GGKLYEFSNV  60
GVGRTIERYY RCKDNLLDND TLEDTQGLRQ EVTKLKCKYE SLLRTHRNLV GEDLEGMSIK  120
ELQTLERQLE GALSATRKQK TQVMMEQMEE LRRKERELGD INNKLKLETE DHDFKGFQDL  180
LLNPVLTAGC STDFSLQSTH QNYISDCNLG YFLQIGFQQH YEQGEGSSVT KSNARSDAET  240
NFVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q8e-20169169Myocyte-specific enhancer factor 2B
1tqe_R8e-20169169Myocyte-specific enhancer factor 2B
1tqe_S8e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184118490.0
Genevisible251312_at0.0
Expression AtlasAT3G61120-
AtGenExpressAT3G61120-
ATTED-IIAT3G61120-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Function -- GeneRIF ? help Back to Top
  1. AGL6 and AGL13 are regulated through complex interactions of enhancer and silencer elements located in both the 5'-upstream regions and the large first introns.
    [PMID: 19473325]
  2. AGL13 is likely a putative ancestor for the E functional genes which specifies male and female gametophyte morphogenesis in plants during evolution.
    [PMID: 24164574]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00417DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G61120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G18960, AT4G37940, AT1G48150
IntActSearch Q38837
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G61120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU201830.0U20183.1 Arabidopsis thaliana MADS-box protein AGL13 (AGL13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191671.11e-179agamous-like MADS-box protein AGL13
SwissprotQ388370.0AGL13_ARATH; Agamous-like MADS-box protein AGL13
TrEMBLD7LS601e-166D7LS60_ARALL; Putative uncharacterized protein
STRINGAT3G61120.11e-179(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43022654
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  5. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  6. Chatelet P, et al.
    Characterization of Vitis vinifera L. somatic variants exhibiting abnormal flower development patterns.
    J. Exp. Bot., 2007. 58(15-16): p. 4107-18
    [PMID:18042806]
  7. Schauer SE, et al.
    Intronic regulatory elements determine the divergent expression patterns of AGAMOUS-LIKE6 subfamily members in Arabidopsis.
    Plant J., 2009. 59(6): p. 987-1000
    [PMID:19473325]
  8. Hsu WH, et al.
    AGAMOUS-LIKE13, a putative ancestor for the E functional genes, specifies male and female gametophyte morphogenesis.
    Plant J., 2014. 77(1): p. 1-15
    [PMID:24164574]
  9. Rounsley SD,Ditta GS,Yanofsky MF
    Diverse roles for MADS box genes in Arabidopsis development.
    Plant Cell, 1995. 7(8): p. 1259-69
    [PMID:7549482]